Iright
BRAND / VENDOR: Proteintech

Proteintech, 21590-1-AP, OGFOD2 Polyclonal antibody

CATALOG NUMBER: 21590-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The OGFOD2 (21590-1-AP) by Proteintech is a Polyclonal antibody targeting OGFOD2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 21590-1-AP targets OGFOD2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, human testis tissue, human skeletal muscle tissue, mouse liver tissue, rat liver tissue Positive IHC detected in: mouse brain tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information OGFOD2 belongs to the OGFOD2 family. OGFOD2 has 4 isoforms with the molecular mass of 15, 20, 32 and 39 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16164 Product name: Recombinant human OGFOD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-206 aa of BC098293 Sequence: FTAPFCQALLEELEHFEQSDMPKGRPNTMNNYGVLLHELGLDEPLMTPLRERFLQPLMALLYPDCGGGRLDSHRAFVVKYAPGQDLELGCHYDNAELTLNVALGKVFTGGALYFGGLFQAPTALTEPLEVEHVVGQGVLHRGGQLHGARPLGTGERWNLVVWLRASAVRNSLCPMCCREPDLVDDEGFGDGFTREEPATVDVCALT Predict reactive species Full Name: 2-oxoglutarate and iron-dependent oxygenase domain containing 2 Calculated Molecular Weight: 350 aa, 39 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC098293 Gene Symbol: OGFOD2 Gene ID (NCBI): 79676 RRID: AB_10734327 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6N063 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924