Proteintech, 21593-1-AP, NGX6 Polyclonal antibody

Size: 20ul / 150ul The NGX6 (21593-1-AP) by Proteintech is a Polyclonal antibody targeting NGX6 in IHC, ELISA applications with reactivity to human, mouse, rat samples 21593-1-AP targets NGX6 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: human stomach cancer tissue, human colon cancer tissue, mouse intestine, rat small intestine tissue, rat stomach tissue, mouse stomach tissue, mouse testis tissue, human cervical cancer tissue, rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information NGX6 (also known as TMEM8B or C9orf127) is a transmembrane protein containing an epidermal growth factor (EGF)-like domain. It may function as a regulator of the EGFR pathway. NGX6 has been reported as a tumor suppressor which may function in cell growth, proliferation and adhesion (PMID: 19755717; 12918109; 20705583). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16167 Product name: Recombinant human C9orf127 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-191 aa of BC098296 Sequence: MNMPQSLGNQPLPPEPPSLGTPAEGPGTTSPPEHCWPVRPTLRNELDTFSVHFYIFFGPSVALPPERPAVFAMRLLPVLDSGGVLSLELQLNASSVRQENVTVFGCLTHEVPLSLGDAAVTCSKESLAGFLLSVSATTRVARLRIPFPQTGTWFLALRSLCGVGPRFVRCRNATAEVWMRTFLSPCVDDCG Predict reactive species Full Name: chromosome 9 open reading frame 127 Calculated Molecular Weight: 472 aa, 52 kDa GenBank Accession Number: BC098296 Gene Symbol: NGX6 Gene ID (NCBI): 51754 RRID: AB_2878889 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: A6NDV4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.