Iright
BRAND / VENDOR: Proteintech

Proteintech, 21612-1-AP, PFTK1 Polyclonal antibody

CATALOG NUMBER: 21612-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PFTK1 (21612-1-AP) by Proteintech is a Polyclonal antibody targeting PFTK1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 21612-1-AP targets PFTK1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, mouse brain tissue, SH-SY5Y cells Positive IHC detected in: human kidney tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information PFTK1 is a Cdc2-related protein kinase, also named as PFTAIRE1, CDK14 and belongs to the CMGC Ser/Thr protein kinase family and CDC2/CDKX subfamily. It acts as a cyclin-dependent kinases that regulates cell cycle progression and cell proliferation. The PFTK1 protein shows high homology with mouse Pftaire1, a Cdc2-related protein expressed primarily in the postnatal and adult nervous system(PMID:9202329). The protein contains 2 predicted nuclear localization signals that the N-terminal nuclear localization signals do not play a role in vivo(PMID:11313143). It has 3 isoforms produced by alternative splicing. This antibody is specific to PFTK1. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16259 Product name: Recombinant human PFTK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 303-451 aa of BC136477 Sequence: IFVEMIQGVAAFPGMKDIQDQLERIFLVLGTPNEDTWPGVHSLPHFKPERFTLYSSKNLRQAWNKLSYVNHAEDLASKLLQCSPKNRLSAQAALSHEYFSDLPPRLWELTDMSSIFTVPNVRLQPEAGESMRAFGKNNSYGKSLSNSKH Predict reactive species Full Name: PFTAIRE protein kinase 1 Calculated Molecular Weight: 469 aa, 53 kDa Observed Molecular Weight: 48-53 kDa GenBank Accession Number: BC136477 Gene Symbol: PFTK1 Gene ID (NCBI): 5218 RRID: AB_10858924 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O94921 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924