Iright
BRAND / VENDOR: Proteintech

Proteintech, 21614-1-AP, SGCZ Polyclonal antibody

CATALOG NUMBER: 21614-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SGCZ (21614-1-AP) by Proteintech is a Polyclonal antibody targeting SGCZ in WB, IF-P, ELISA applications with reactivity to human, mouse, rat samples 21614-1-AP targets SGCZ in WB, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, mouse brain tissue, rat heart tissue Positive IF-P detected in: mouse heart tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information Sarcoglycan zeta, also known as SGCZ, ZSG1, is part of the sarcoglycan complex. The sarcoglycan complex is part of the dystrophin-associated glycoprotein complex (DGC), which bridges the inner cytoskeleton and the extracellular matrix. SGCZ plays a role in the maintenance of striated muscle membrane stability. SGCZ was also found as a component of the vascular smooth muscle sarcoglycan complex. SGCZ was reduced at the membrane in muscular dystrophy (PMID: 12189167). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16305 Product name: Recombinant human SGCZ protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 67-265 aa of BC125037 Sequence: SPLVLQSDRNVTVNARNHMGQLTGQLTIGADAVEAQCKRFEVRASEDGRVLFSADEDEITIGAEKLKVTGTEGAVFGHSVETPHIRAEPSQDLRLESPTRSLIMEAPRGVQVSAAAGDFKATCRKELHLQSTEGEIFLNAETIKLGNLPTGSFSSSSPSSSSSRQTVYELCVCPNGKLYLSPAGVGSTCQSSSNICLWS Predict reactive species Full Name: sarcoglycan zeta Calculated Molecular Weight: 265 aa, 30 kDa Observed Molecular Weight: 30-40 kDa GenBank Accession Number: BC125037 Gene Symbol: SGCZ Gene ID (NCBI): 137868 RRID: AB_3085662 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96LD1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924