Iright
BRAND / VENDOR: Proteintech

Proteintech, 21650-1-AP, oncomodulin Polyclonal antibody

CATALOG NUMBER: 21650-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The oncomodulin (21650-1-AP) by Proteintech is a Polyclonal antibody targeting oncomodulin in IHC, ELISA applications with reactivity to human samples 21650-1-AP targets oncomodulin in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Oncomodulin (OCM) is a small EF-hand Ca2+-binding protein (CaBP) of approximately 12 kDa belonging to the parvalbumin family. Oncomodulin (OCM) consists of two active Ca2+-specific domains of the EF-hand type ("helix-loop-helix" motif), covered by an EF-hand domain with inactive EF-hand loop, which contains a highly conservative cysteine with unknown function. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16358 Product name: Recombinant human OCM protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-109 aa of BC113706 Sequence: MSITDVLSADDIAAALQECRDPDTFEPQKFFQTSGLSKMSANQVKDVFRFIDNDQSGYLDEEELKFFLQKFESGARELTESETKSLMAAADNDGDGKIGAEEFQEMVHS Predict reactive species Full Name: oncomodulin Calculated Molecular Weight: 109 aa, 12 kDa GenBank Accession Number: BC113706 Gene Symbol: Oncomodulin Gene ID (NCBI): 654231 RRID: AB_3669371 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P0CE72 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924