Iright
BRAND / VENDOR: Proteintech

Proteintech, 21654-1-AP, PPYR1 Polyclonal antibody

CATALOG NUMBER: 21654-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PPYR1 (21654-1-AP) by Proteintech is a Polyclonal antibody targeting PPYR1 in IHC, ELISA applications with reactivity to human samples 21654-1-AP targets PPYR1 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information PPYR1 (pancreatic polypeptide receptor 1), also known as NPY4R, is a member of the G-protein coupled receptor 1 family. PPYR1 is a receptor for the PP-fold peptides (pancreatic polypeptide, peptide YY, and neuropeptide Y) and pancreatic polypeptide is the preferred ligand (PMID: 12626767). It may be regulating central nervous system, cardiovascular and gastrointestinal function. It has been reported that PPYR1 gene is a key regulator of energy homeostasis (PMID: 12000791). PPYR1 gene copy number gain has been associated with lower body mass index (BMI) (PMID: 19229253). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16374 Product name: Recombinant human PPYR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 317-375 aa of BC096238 Sequence: VNPFIYGFLNTNFKKEIKALVLTCQQSAPLEESEHLPLSTVHTEVSKGSLRLSGRSNPI Predict reactive species Full Name: pancreatic polypeptide receptor 1 Calculated Molecular Weight: 375 aa, 42 kDa GenBank Accession Number: BC096238 Gene Symbol: PPYR1 Gene ID (NCBI): 5540 RRID: AB_2878900 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P50391 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924