Proteintech, 21657-1-AP, CNGA3 Polyclonal antibody

Size: 20ul / 150ul The CNGA3 (21657-1-AP) by Proteintech is a Polyclonal antibody targeting CNGA3 in WB, IP, IHC, ELISA applications with reactivity to human, mouse samples 21657-1-AP targets CNGA3 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells Positive IP detected in: mouse brain tissue Positive IHC detected in: mouse eye tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information CNGA3 is a member of the cyclic nucleotide-gated cation channel protein family which is required for normal vision and olfactory signal transduction. Mutations in CNGA3 gene are associated with achromatopsia (rod monochromacy) and color blindness. Three alternatively spliced transcripts encoding different isoforms have been described. This antibody detects CNGA3 with an apparent molecular weight of 98 kDa which has been reported (PMID: 20378608). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16385 Product name: Recombinant human CNGA3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 590-694 aa of BC096298 Sequence: EYPEAKKALEEKGRQILMKDNLIDEELARAGADPKDLEEKVEQLGSSLDTLQTRFARLLAEYNATQMKMKQRLSQLESQVKGGGDKPLADGEVPGDATKTEDKQQ Predict reactive species Full Name: cyclic nucleotide gated channel alpha 3 Calculated Molecular Weight: 694 aa, 79 kDa Observed Molecular Weight: 98 kDa GenBank Accession Number: BC096298 Gene Symbol: CNGA3 Gene ID (NCBI): 1261 RRID: AB_10734591 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q16281 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.