Proteintech, 21672-1-AP, SIP1 Polyclonal antibody

Size: 20ul / 150ul The SIP1 (21672-1-AP) by Proteintech is a Polyclonal antibody targeting SIP1 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 21672-1-AP targets SIP1 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, HeLa cells, rat brain tissue Positive IP detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16500 Product name: Recombinant human SIP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-280 aa of BC104968 Sequence: MRRAELAGLKTMAWVPAESAVEELMPRLLPVEPCDLTEGFDPSVPPRTPQEYLRRVQIEAAQCPDVVVAQIDPKKLKRKQSVNISLSGCQPAPEGYSPTLQWQQQQVAQFSTVRQNVNKHRSHWKSQQLDSNVTMPKSEDEEGWKKFCLGEKLCADGAVGPATNESPGIDYVQIGFPPLLSIVSRMNQATVTSVLEYLSNWFGERDFTPELGRWLYALLACLEKPLLPEAHSLIRQLARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPS Predict reactive species Full Name: survival of motor neuron protein interacting protein 1 Calculated Molecular Weight: 280 aa, 32 kDa Observed Molecular Weight: 32-35 kDa GenBank Accession Number: BC104968 Gene Symbol: SIP1 Gene ID (NCBI): 8487 RRID: AB_10859249 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14893 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.