Iright
BRAND / VENDOR: Proteintech

Proteintech, 21685-1-AP, Trehalase Polyclonal antibody

CATALOG NUMBER: 21685-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Trehalase (21685-1-AP) by Proteintech is a Polyclonal antibody targeting Trehalase in WB, IF-P, ELISA applications with reactivity to human, mouse samples 21685-1-AP targets Trehalase in WB, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse small intestine tissue Positive IF-P detected in: human kidney tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information Trehalase is the enzyme hydrolyzing trehalose and belongs to the glycosyl hydrolase 37 family. In humans and most mammals, trehalase is found in the brush borders of the intestinal mucosa, kidney, liver, and blood plasma. Trehalases are conserved enzymes that catalyze the hydrolysis of one of two glycoside bonds of trehalose. With the exception of vertebrates where trehalase is required for the degradation of ingested trehalose, in other animal groups it is involved in diverse physiological processes including carbohydrate metabolism, resumption of growth in certain resting cells, germination of spores in fungi, recovery from stress conditions, etc (PMID: 25429048, PMID: 30628830). Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16246 Product name: Recombinant human TREH protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 203-552 aa of BC109206 Sequence: YLTHTNDTAFLQENIETLALELDFWTKNRTVSVSLEGKNYLLNRYYVPYGGPRPESYSKDVELADTLPEGDREALWAELKAGAESGWDFSSRWLIGGPNPNSLSGIRTSKLVPVDLNAFLCQAEELMSNFYSRLGNDSQATKYRILRSQRLAALNTVLWDEQTGAWFDYDLEKKKKNREFYPSNLTPLWAGCFSDPGVADKALKYLEDNRILTYQYGIPTSLQKTGQQWDFPNAWAPLQDLVIRGLAKAPLRRAQEVAFQLAQNWIRTNFDVYSQKSAMYEKYDVSNGGQPGGGGEYEVQEGFGWTNGVVLMLLDRYGDRLTSGAKLAFLEPHCLAATLLPSLLLSLLPW Predict reactive species Full Name: trehalase (brush-border membrane glycoprotein) Calculated Molecular Weight: 583 aa, 67 kDa Observed Molecular Weight: 67-70 kDa GenBank Accession Number: BC109206 Gene Symbol: Trehalase Gene ID (NCBI): 11181 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: O43280 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924