Iright
BRAND / VENDOR: Proteintech

Proteintech, 21708-1-AP, PI3 Kinase p110 Delta Polyclonal antibody

CATALOG NUMBER: 21708-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PI3 Kinase p110 Delta (21708-1-AP) by Proteintech is a Polyclonal antibody targeting PI3 Kinase p110 Delta in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 21708-1-AP targets PI3 Kinase p110 Delta in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, Raji cells, RAW 264.7 cells Positive IF/ICC detected in: LNCaP cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human, mouse Cited Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16326 Product name: Recombinant human PIK3CD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 130-381 aa of BC132919 Sequence: SLCDPEVNDFRAKMCQFCEEAAARRQQLGWEAWLQYSFPLQLEPSAQTWGPGTLRLPNRALLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYTLQVNGRHEYLYGSYPLCQFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPAPQVQKPRAKPPPIPAKKPSSVSLWSLEQPFRIELIQGSKVNADERMKLVVQAGLFHGNEMLCKTVSSSEVSVCSEPVWKQRLEFDINI Predict reactive species Full Name: phosphoinositide-3-kinase, catalytic, delta polypeptide Calculated Molecular Weight: 1044 aa, 120 kDa Observed Molecular Weight: 110-130 kDa GenBank Accession Number: BC132919 Gene Symbol: PIK3CD Gene ID (NCBI): 5293 RRID: AB_3085666 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00329 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924