Proteintech, 21722-1-AP, SLC13A2 Polyclonal antibody

Size: 20ul / 150ul The SLC13A2 (21722-1-AP) by Proteintech is a Polyclonal antibody targeting SLC13A2 in IHC, ELISA applications with reactivity to human, mouse samples 21722-1-AP targets SLC13A2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: human kidney tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SLC13A2 (Solute Carrier Family 13 Member 2) is involved in the transport of citric acid cycle intermediates, such as succinate, citrate, fumarate, and alpha-ketoglutarate (2-oxoglutarate), across cell membranes. In the liver, SLC13A2 has been shown to promote metabolic remodeling by transporting citrate, which is then converted to acetyl-CoA, a precursor for cholesterol synthesis and fatty acid metabolism (PMID: 39824985). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16379 Product name: Recombinant human SLC13A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 129-231 aa of BC096277 Sequence: MLVTAFLSMWISNTATSAMMVPIAHAVLDQLHSSQASSNVEEGSNNPTFELQEPSPQKEVTKLDNGQALPVTSASSEGRAHLSQKHLHLTQCMSLCVCYSASI Predict reactive species Full Name: solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 2 Calculated Molecular Weight: 592 aa, 64 kDa GenBank Accession Number: BC096277 Gene Symbol: SLC13A2 Gene ID (NCBI): 9058 RRID: AB_2878912 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13183 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.