Iright
BRAND / VENDOR: Proteintech

Proteintech, 21737-1-AP, CDH9 Polyclonal antibody

CATALOG NUMBER: 21737-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CDH9 (21737-1-AP) by Proteintech is a Polyclonal antibody targeting CDH9 in WB, ELISA applications with reactivity to human samples 21737-1-AP targets CDH9 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information CDH9, also known as Cadherin 9, is a type of cadherin that plays a significant role in cell adhesion and tissue organization. It is a member of the cadherin superfamily, which is a group of transmembrane glycoproteins that mediate cell-cell adhesion. (PMID: 36315446) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16437 Product name: Recombinant human CDH9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 469-541 aa of BC113745 Sequence: SSHIPVFIRILDINDHAPEFAMYYETFVCENAKPGQLIQTVSVMDKDDPPRGHKFFFEPVPEFTLNPNFTIVD Predict reactive species Full Name: cadherin 9, type 2 (T1-cadherin) Calculated Molecular Weight: 789 aa, 89 kDa Observed Molecular Weight: 107 kDa GenBank Accession Number: BC113745 Gene Symbol: CDH9 Gene ID (NCBI): 1007 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9ULB4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924