Iright
BRAND / VENDOR: Proteintech

Proteintech, 21741-1-AP, CARD11 Polyclonal antibody

CATALOG NUMBER: 21741-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CARD11 (21741-1-AP) by Proteintech is a Polyclonal antibody targeting CARD11 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 21741-1-AP targets CARD11 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Raji cells, mouse thymus tissue Positive IHC detected in: human colon cancer tissue, human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: L02 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information CARD11 also named as ,BIMP3 or CARMA1, is a 1154 amino acid protein, which contains one PDZ domain, one guanylate kinase-like domain, and one CARD domain. CARD11 localizes in the cytoplasm and co-localized with DPP4 in membrane raft. CARD11 is detected in adult peripheral blood leukocytes, thymus, spleen and liver. CARD11 also is found in CARD11 promyelocytic leukemia HL-60 cells, chronic myelogenous leukemia K-562 cells, Burkitt's lymphoma Raji cells and colorectal adenocarcinoma SW480 cells. CARD11 is involved in the co-stimulatory signal essential for T-cell receptor mediated T-cell activation. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16468 Product name: Recombinant human CARD11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 798-1147 aa of BC111719 Sequence: DTMYQDRHEWLCARVDPFTDHDLDMGTIPSYSRAQQLLLVKLQRLMHRGSREEVDGTHHTLRALRNTLQPEEALSTSDPRVSPRLSRASFLFGQLLQFVSRSENKYKRMNSNERVRIISGSPLGSLARSSLDATKLLTEKQEELDPESELGKNLSLIPYSLVRAFYCERRRPVLFTPTVLAKTLVQRLLNSGGAMEFTICKSDIVTRDEFLRRQKTETIIYSREKNPNAFECIAPANIEAVAAKNKHCLLEAGIGCTRDLIKSNIYPIVLFIRVCEKNIKRFRKLLPRPETEEEFLRVCRLKEKELEALPCLYATVEPDMWGSVEELLRVVKDKIGEEQRKTIWVDEDQL Predict reactive species Full Name: caspase recruitment domain family, member 11 Calculated Molecular Weight: 1154 aa, 133 kDa Observed Molecular Weight: 133 kDa GenBank Accession Number: BC111719 Gene Symbol: CARD11 Gene ID (NCBI): 84433 RRID: AB_2878915 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BXL7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924