Iright
BRAND / VENDOR: Proteintech

Proteintech, 21766-1-AP, GABRA6 Polyclonal antibody

CATALOG NUMBER: 21766-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GABRA6 (21766-1-AP) by Proteintech is a Polyclonal antibody targeting GABRA6 in IHC, IF-P, ELISA applications with reactivity to human, mouse samples 21766-1-AP targets GABRA6 in IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse cerebellum tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:250-1:1000 Background Information Gamma-aminobutyric acid (GABA) is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABAA receptors, which are ligand-gated chloride channels. GABAA receptors are formed by pentameric assembly of 19 different subunit subtypes (α1-α6, β1-β3, γ1-γ3, δ, ɛ, π, θ and ρ1-ρ3) (PMID: 21930603). The mutation R46W of GABRA6 is associated with the pathogenesis of childhood absence epilepsy (CAE) (PMID: 21930603). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16375 Product name: Recombinant human GABRA6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 329-424 aa of BC096241 Sequence: NLQTQKAKRKAQFAAPPTVTISKATEPLEAEIVLHPDSKYHLKKRITSLSLPIVSSSEANKVLTRAPILQSTPVTPPPLSPAFGGTSKIDQYSRIL Predict reactive species Full Name: gamma-aminobutyric acid (GABA) A receptor, alpha 6 Calculated Molecular Weight: 453 aa, 51 kDa GenBank Accession Number: BC096241 Gene Symbol: GABRA6 Gene ID (NCBI): 2559 RRID: AB_3085671 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q16445 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924