Proteintech, 21809-1-AP, CD52 Polyclonal antibody

Size: 20ul / 150ul The CD52 (21809-1-AP) by Proteintech is a Polyclonal antibody targeting CD52 in IHC, ELISA applications with reactivity to human samples 21809-1-AP targets CD52 in IF, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17788 Product name: Recombinant human CD52 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 20-61 aa of BC000644 Sequence: QTGLSGQNDTSQTSSPSASSSMSGGIFLFFVANAIIHLFCFS Predict reactive species Full Name: CD52 molecule Calculated Molecular Weight: 6 kDa GenBank Accession Number: BC000644 Gene Symbol: CD52 Gene ID (NCBI): 1043 RRID: AB_2878920 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P31358 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.