Iright
BRAND / VENDOR: Proteintech

Proteintech, 21874-1-AP, AMIGO1 Polyclonal antibody

CATALOG NUMBER: 21874-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The AMIGO1 (21874-1-AP) by Proteintech is a Polyclonal antibody targeting AMIGO1 in WB, ELISA applications with reactivity to human, mouse, rat samples 21874-1-AP targets AMIGO1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information AMIGO1 is a brain-enriched transmembrane immunoglobulin (Ig) superfamily protein with six extracellular leucine-rich repeats (LRR) and a single immunoglobulin-like (Ig) domain (PMID: 21938721). It is widely expressed in the central nervous system (CNS), and can be found in neurons, astrocytes as well as oligodendrocytes. AMIGO1 acts as a homophilic adhesion molecule that induces outgrowth and fasciculation of neurites in central neurons (PMID: 12629050). It has been reported that AMIGO1 is a glycosylated protein, the apparent molecular weight (70-80 kDa) is much higher than the predicted molecular size of AMIGO1 (55 kDa) (PMID: 12629050; 21938721; 22056818). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16226 Product name: Recombinant human AMIGO1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 224-493 aa of BC040879 Sequence: NCDCELYQLFSHWQYRQLSSVMDFQEDLYCMNSKKLHNVFNLSFLNCGEYKERAWEAHLGDTLIIKCDTKQQGMTKVWVTPSNERVLDEVTNGTVSVSKDGSLLFQQVQVEDGGVYTCYAMGETFNETLSVELKVHNFTLHGHHDTLNTAYTTLVGCILSVVLVLIYLYLTPCRCWCRGVEKPSSHQGDSLSSSMLSTTPNHDPMAGGDKDDGFDRRVAFLEPAGPGQGQSGKLKPGNTLPVPEATGKGQRRMSDPESVSSVFSDTPIVV Predict reactive species Full Name: adhesion molecule with Ig-like domain 1 Calculated Molecular Weight: 493 aa, 55 kDa Observed Molecular Weight: 70-80 kDa GenBank Accession Number: BC040879 Gene Symbol: AMIGO1 Gene ID (NCBI): 57463 RRID: AB_2878935 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86WK6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924