Proteintech, 21875-1-AP, EphA4 Polyclonal antibody

Size: 20ul / 150ul The EphA4 (21875-1-AP) by Proteintech is a Polyclonal antibody targeting EphA4 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 21875-1-AP targets EphA4 in WB, IHC, IF/ICC, IP, ELISA, Cell treatment applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Neuron cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information EphA4 is a member of the Eph receptor tyrosine kinase family and has important functions in the developing and adult nervous system (PMID: 14697664). The Eph receptors comprise a large family of closely related transmembrane tyrosine kinases that actively signal when bound to their ephrin ligands. The Eph receptors are characterized by an extracellular region with a unique cysteine-rich motif extending over its amino-terminal half, followed by two fibronectin type III motifs (PMID: 9530499). They are divided into two sub-groups (EphA and EphB) based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands (PMID: 11114742). EphA4 is involved in commissure formation within the forebrain, axonal guidance in the corticospinal tract, regulation of the central pattern generator that provides normal locomotor function and axonal regeneration following spinal cord injury (PMID: 30061574). EphA4 has been implicated as a disease modifier of amyotrophic lateral sclerosis (ALS) (PMID: 22922411). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16233 Product name: Recombinant human EPHA4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 481-603 aa of BC026327 Sequence: KDQNERSYRIVRTAARNTDIKGLNPLTSYVFHVRARTAAGYGDFSEPLEVTTNTVPSRIIGDGANSTVLLVSVSGSVVLVVILIAAFVISRRRSKYSKAKQEADEEKHLNQGVRTYVDPFTYE Predict reactive species Full Name: EPH receptor A4 Calculated Molecular Weight: 986 aa, 110 kDa Observed Molecular Weight: 120 kDa GenBank Accession Number: BC026327 Gene Symbol: EPHA4 Gene ID (NCBI): 2043 RRID: AB_2878936 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P54764 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.