Iright
BRAND / VENDOR: Proteintech

Proteintech, 21884-1-AP, PPTC7 Polyclonal antibody

CATALOG NUMBER: 21884-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PPTC7 (21884-1-AP) by Proteintech is a Polyclonal antibody targeting PPTC7 in WB, ELISA applications with reactivity to human, mouse samples 21884-1-AP targets PPTC7 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: U-251 cells, mouse brain tissue, mouse skeletal muscle tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information PPTC7 (Protein phosphatase PTC7 homolog, also named TAPP2C) is a resident mitochondrial phosphatase essential for maintaining proper mitochondrial content and function (PMID: 37833277). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16469 Product name: Recombinant human PPTC7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-304 aa of BC111551 Sequence: MFSVLSYGRLVARAVLGGLSQTDPRAGGGGGGDYGLVTAGCGFGKDFRKGLLKKGACYGDDACFVARHRSADVLGVADGVGGWRDYGVDPSQFSGTLMRTCERLVKEGRFVPSNPIGILTTSYCELLQNKVPLLGSSTACIVVLDRTSHRLHTANLGDSGFLVVRGGEVVHRSDEQQHYFNTPFQLSIAPPEAEGVVLSDSPDAADSTSFDVQLGDIILTATDGLFDNMPDYMILQELKKLKNSNYESIQQTARSIAEQAHELAYDPNYMSPFAQFACDNGLNVRGGKPDDITVLLSIVAEYTD Predict reactive species Full Name: PTC7 protein phosphatase homolog (S. cerevisiae) Calculated Molecular Weight: 304 aa, 33 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC111551 Gene Symbol: PPTC7 Gene ID (NCBI): 160760 RRID: AB_3669380 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NI37 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924