Iright
BRAND / VENDOR: Proteintech

Proteintech, 21899-1-AP, AGMAT Polyclonal antibody

CATALOG NUMBER: 21899-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The AGMAT (21899-1-AP) by Proteintech is a Polyclonal antibody targeting AGMAT in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 21899-1-AP targets AGMAT in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse skeletal muscle tissue, rat skeletal muscle tissue Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunohistochemistry (IHC): IHC : 1:800-1:3200 Background Information AGMAT is a metallohydrolase and belongs to the arginase family. AGMAT plays an important role in amino acid metabolism and can hydrolyze agmatine into urea and putrescine. AGMAT has been shown to play an important role in the development of tumors, including colorectal cancer, lung adenocarcinoma, and pancreatic adenocarcinoma(PMID: 36680755; PMID: 31699997; PMID: 35837051 ). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13609 Product name: Recombinant human AGMAT protein Source: e coli. -derived, PKG Tag: GST Domain: 1-300 aa of BC005090 Sequence: MLRLLASGCARGPGPGVGARPAAGLFHPGRRQSRQASDAPRNQPPSPEFVARPVGVCSMMRLPVQTSPEGLDAAFIGVPLDTGTSNRPGARFGPRRIREESVMLRTVNPSTGALPFQSLMVADLGDVNVNLYNLQDSCRRIQEAYEKIVAAGCIPLTLGGDHTITYPILQAMAKKHGPVGLLHVDAHTDTTDKALGEKLYHGAPFRRCVDEGLLDCKRVVQIGIRGSSTTLDPYRYNRSQGFRVVLAEDCWMKSLVPLMGEVRQQMGGKPIYISFDIDALDPAYAPGTGTPEIAGLTPSQ Predict reactive species Full Name: agmatine ureohydrolase (agmatinase) Calculated Molecular Weight: 38 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC005090 Gene Symbol: AGMAT Gene ID (NCBI): 79814 RRID: AB_3085677 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BSE5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924