Proteintech, 21907-1-AP, ZNF614 Polyclonal antibody

Size: 20ul / 150ul The ZNF614 (21907-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF614 in IP, ELISA applications with reactivity to human samples 21907-1-AP targets ZNF614 in IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive IP detected in: A549 cells Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information ZNF614 (Zinc Finger Protein 614) is a protein encoded by the ZNF614 gene in humans. It belongs to the zinc finger protein family, which typically functions in DNA binding and transcriptional regulation. Zinc finger proteins play roles in various cellular processes, including gene expression, cell differentiation, and development. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14991 Product name: Recombinant human ZNF614 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-160 aa of BC004930 Sequence: MIKTQESLTLEDVAVEFSWEEWQLLDTAQKNLYRDVMVENYNHLVSLGYQTSKPDVLSKLAHGQEPWTTDAKIQNKNCPGIGKVDSHLQEHSPNQRLLKSVQQCNGQNTLRNIVHLSKTHFPIVQNHDTFDLYRKNLKSSLSLINQKRRHGINNPVEFIG Predict reactive species Full Name: zinc finger protein 614 Calculated Molecular Weight: 585 aa, 67 kDa Observed Molecular Weight: 67 kDa GenBank Accession Number: BC004930 Gene Symbol: ZNF614 Gene ID (NCBI): 80110 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N883 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.