Iright
BRAND / VENDOR: Proteintech

Proteintech, 21939-1-AP, CHRNA4 Polyclonal antibody

CATALOG NUMBER: 21939-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CHRNA4 (21939-1-AP) by Proteintech is a Polyclonal antibody targeting CHRNA4 in WB, ELISA applications with reactivity to human, Mouse samples 21939-1-AP targets CHRNA4 in WB, ELISA applications and shows reactivity with human, Mouse samples. Tested Applications Positive WB detected in: Neuro-2a cells, C6 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information This gene encodes a nicotinic acetylcholine receptor, which belongs to a superfamily of ligand-gated ion channels that play a role in fast signal transmission at synapses. These pentameric receptors can bind acetylcholine, which causes an extensive change in conformation that leads to the opening of an ion-conducting channel across the plasma membrane. This protein is an integral membrane receptor subunit that can interact with either nAChR beta-2 or nAChR beta-4 to form a functional receptor. Mutations in this gene cause nocturnal frontal lobe epilepsy type 1. Specification Tested Reactivity: human, Mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16584 Product name: Recombinant human CHRNA4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 334-573 aa of BC096290 Sequence: SPRTHTMPTWVRRVFLDIVPRLLLMKRPSVVKDNCRRLIESMHKMASAPRFWPEPEGEPPATSGTQSLHPPSPSFCVPLDVPAEPGPSCKSPSDQLPPQQPLEAEKASPHPSPGPCRPPHGTQAPGLAKARSLSVQHMSSPGEAVEGGVRCRSRSIQYCVPRDDAAPEADGQAAGALASRNTHSAELPPPDQPSPCKCTCKKEPSSVSPSATVKTRSTKAPPPHLPLSPALTRAVEGVQY Predict reactive species Full Name: cholinergic receptor, nicotinic, alpha 4 Calculated Molecular Weight: 627 aa, 70 kDa Observed Molecular Weight: 69 kDa GenBank Accession Number: BC096290 Gene Symbol: CHRNA4 Gene ID (NCBI): 1137 RRID: AB_3085680 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P43681 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924