Iright
BRAND / VENDOR: Proteintech

Proteintech, 21970-1-AP, MACC1 Polyclonal antibody

CATALOG NUMBER: 21970-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MACC1 (21970-1-AP) by Proteintech is a Polyclonal antibody targeting MACC1 in IHC, ELISA applications with reactivity to human, mouse samples 21970-1-AP targets MACC1 in IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: human liver cancer tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information MACC1, Metalloantigenolytic Cleavage Cartilage Proteinase 1, belongs to the ADAM (a disintegrin and metalloprotease) family. MACC1 was first identified in colon cancer. It is a key prognostic biomarker and is involved in recurrence, metastasis, and survival in solid cancers (PMID: 23815185). MACC1 expression is primarily observed in cartilage, but it's also present in other tissues like bone, synovium, and the developing nervous system (PMID: 36979146). Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16884 Product name: Recombinant human MACC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 502-852 aa of BC137090 Sequence: ITTPDPTPNLKRLSNLPGYLQKKEEIKSAPLSPKILVKYPTFQDKTLNFSNYGVTLKAVLRQSKIDYFLEYFKGDTIALLGEGKVKAIGQSKVKEWYVGVLRGKIGLVHCKNVKVISKEQVMFMSDSVFTTRNLLEQIVLPLKKLTYIYSVVLTLVSEKVYDWKVLADVLGYSHLSLEDFDQIQADKESEKVSYVIKKLKEDCHTERNTRKFLYELIVALLKMDCQELVARLIQEAAVLTSAVKLGKGWRELAEKLVRLTKQQMEAYEIPHRGNTGDVAVEMMWKPAYDFLYTWSAHYGNNYRDVLQDLQSALDRMKNPVTKHWRELTGVLILVNSLEVLRVTAFSTSEEV Predict reactive species Full Name: metastasis associated in colon cancer 1 Calculated Molecular Weight: 852 aa, 97 kDa GenBank Accession Number: BC137090 Gene Symbol: MACC1 Gene ID (NCBI): 346389 RRID: AB_2878957 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6ZN28 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924