Proteintech, 21973-1-AP, GFRA2 Polyclonal antibody

Size: 20ul / 150ul The GFRA2 (21973-1-AP) by Proteintech is a Polyclonal antibody targeting GFRA2 in WB, IHC, ELISA applications with reactivity to human, mouse samples 21973-1-AP targets GFRA2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HepG2 cells, mouse brain tissue, L02 cells, U-87 MG cells Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information GFRA2, also named as GDNFRB, RETL2 and TRNR2, belongs to the GDNFR family. It is a receptor for neurturin. GFRA2 mediates the NRTN-induced autophosphorylation and activation of the RET receptor. It is a potent survival factor for central dopaminergic neurons, motor neurons, and several other populations of neurons in the central and peripheral nervous systems. The GDNF signal is mediated by a complex of the receptor tyrosine kinase RET and a glycosylphosphatidylinositol (GPI)-linked protein, GDNFRA. GFRA2 has three isoforms with MW 34-36 kDa, 39-41 kDa and 50-55 kDa. This antibody recognizes all the three isoforms. Specification Tested Reactivity: human, mouse Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16893 Product name: Recombinant human GFRA2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 270-464 aa of BC041688 Sequence: DFHANCRASYQTVTSCPADNYQACLGSYAGMIGFDMTPNYVDSSPTGIVVSPWCSCRGSGNMEEECEKFLRDFTENPCLRNAIQAFGNGTDVNVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLKANNSKELSMCFTELTTNIIPGSNKVIKPNSGPSRARPSAALTVLSVLMLKLAL Predict reactive species Full Name: GDNF family receptor alpha 2 Calculated Molecular Weight: 464 aa, 52 kDa Observed Molecular Weight: 34-40 kDa, 50-55 kDa GenBank Accession Number: BC041688 Gene Symbol: GFRA2 Gene ID (NCBI): 2675 RRID: AB_11124728 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00451 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.