Iright
BRAND / VENDOR: Proteintech

Proteintech, 21978-1-AP, CHRM3 Polyclonal antibody

CATALOG NUMBER: 21978-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CHRM3 (21978-1-AP) by Proteintech is a Polyclonal antibody targeting CHRM3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 21978-1-AP targets CHRM3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SH-SY5Y cells, mouse brain tissue, rat brain tissue, SK-N-SH cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:200-1:1000 Background Information CHRM3 (M3 muscarinic acetylcholine receptor) is a major player in many kinds of cancer (PMID: 26175851). The expression of muscarinic receptors, mainly the CHRM3, is amplified in several types of tumors, including colon cancer, prostate cancer, endometrial carcinoma, and gastric cancer. Colon cancer overexpresses CHRM3, and post-M3R signaling promotes cell growth via the activation of the epidermal growth factor receptors/ERK and protein kinase C/p38 mitogen-activated protein kinase (MAPK) signaling pathways (PMID: 37744266). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17791 Product name: Recombinant human CHRM3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 261-477 aa of BC121026 Sequence: RTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSMKRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSETRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSFPKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITK Predict reactive species Full Name: cholinergic receptor, muscarinic 3 Calculated Molecular Weight: 590 aa, 66 kDa Observed Molecular Weight: 60-66 kDa GenBank Accession Number: BC121026 Gene Symbol: CHRM3 Gene ID (NCBI): 1131 RRID: AB_3085681 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P20309 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924