Proteintech, 22046-1-AP, C5orf4 Polyclonal antibody

Size: 20ul / 150ul The C5orf4 (22046-1-AP) by Proteintech is a Polyclonal antibody targeting C5orf4 in WB, IHC, ELISA applications with reactivity to human samples 22046-1-AP targets C5orf4 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: COLO 320 cells, A549 cells, HepG2 cells Positive IHC detected in: human liver tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Fatty acid hydroxylase domain containing 2 (FAXDC2), also known as C5orf4, is a 40 kDa protein. The function of FAXDC2 remains largely unknown. The MW of this protein is 25 kDa, and this antibody specially recognises the 25 kDa protein. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16960 Product name: Recombinant human C5orf4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 224-333 aa of BC007216 Sequence: EHAVSNMLPVIVGPLVMGSHLSSITMWFSLALIITTISHCGYHLPFLPSPEFHDYHHLKFNQCYGVLGVLDHLHGTDTMFKQTKAYERHVLLLGFTPLSESIPDSPKRME Predict reactive species Full Name: chromosome 5 open reading frame 4 Calculated Molecular Weight: 333 aa, 39 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC007216 Gene Symbol: C5orf4 Gene ID (NCBI): 10826 RRID: AB_2878979 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96IV6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.