Product Description
Size: 20ul / 150ul
The C5orf4 (22046-1-AP) by Proteintech is a Polyclonal antibody targeting C5orf4 in WB, IHC, ELISA applications with reactivity to human samples
22046-1-AP targets C5orf4 in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: COLO 320 cells, A549 cells, HepG2 cells
Positive IHC detected in: human liver tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:200-1:1000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Background Information
Fatty acid hydroxylase domain containing 2 (FAXDC2), also known as C5orf4, is a 40 kDa protein. The function of FAXDC2 remains largely unknown. The MW of this protein is 25 kDa, and this antibody specially recognises the 25 kDa protein.
Specification
Tested Reactivity: human
Cited Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag16960 Product name: Recombinant human C5orf4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 224-333 aa of BC007216 Sequence: EHAVSNMLPVIVGPLVMGSHLSSITMWFSLALIITTISHCGYHLPFLPSPEFHDYHHLKFNQCYGVLGVLDHLHGTDTMFKQTKAYERHVLLLGFTPLSESIPDSPKRME Predict reactive species
Full Name: chromosome 5 open reading frame 4
Calculated Molecular Weight: 333 aa, 39 kDa
Observed Molecular Weight: 40 kDa
GenBank Accession Number: BC007216
Gene Symbol: C5orf4
Gene ID (NCBI): 10826
RRID: AB_2878979
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q96IV6
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924