Iright
BRAND / VENDOR: Proteintech

Proteintech, 22069-1-AP, OXGR1 Polyclonal antibody

CATALOG NUMBER: 22069-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The OXGR1 (22069-1-AP) by Proteintech is a Polyclonal antibody targeting OXGR1 in WB, ELISA applications with reactivity to human, mouse samples 22069-1-AP targets OXGR1 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, Calu-1 cells, HeLa cells, NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information 2-oxoglutarate receptor 1(OXGR1) also known as GPR99, belongs to the G-protein coupled receptor family. OXGR1is expressed in renal cortical connecting tubule and collecting duct type B intercalated cells. When stimulated by its ligand, OXGR1 mediates cellular calcium uptake, which acts as a signal to promote the chloride-bicarbonate exchanger SLC26A4. Dominant loss-of-function OXGR1 variants are associated with recurrent calcium oxalate NL/NC disease(PMID: 36571463). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17186 Product name: Recombinant human OXGR1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 255-337 aa of BC103881 Sequence: LPFHILRVIRIESRLLSISCSIENQIHEAYIVSRPLAALNTFGNLLLYVVVSDNFQQAVCSTVRCKVSGNLEQAKKISYSNNP Predict reactive species Full Name: oxoglutarate (alpha-ketoglutarate) receptor 1 Calculated Molecular Weight: 337 aa, 38 kDa Observed Molecular Weight: 38-42 kDa GenBank Accession Number: BC103881 Gene Symbol: OXGR1 Gene ID (NCBI): 27199 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96P68 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924