Proteintech, 22080-1-AP, PPP1R14D Polyclonal antibody

Size: 20ul / 150ul The PPP1R14D (22080-1-AP) by Proteintech is a Polyclonal antibody targeting PPP1R14D in WB, ELISA applications with reactivity to human, mouse samples 22080-1-AP targets PPP1R14D in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: COLO 320 cells, mouse colon tissue, rat colon tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17246 Product name: Recombinant human PPP1R14D protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-145 aa of BC096716 Sequence: MLSSSPASCTSPSPDGENPCKKVHWASGRRRTSSTDSESKSHPDSSKIPRSRRPSRLTVKYDRGQLQRWLEMEQWVDAQVQELFQDQATPSEPEIDLEALMDLSTEEQKTQLEAILGNCPRPTEAFISELLSQLKKLRRLSRPQK Predict reactive species Full Name: protein phosphatase 1, regulatory (inhibitor) subunit 14D Calculated Molecular Weight: 145 aa, 17 kDa Observed Molecular Weight: 21 kDa GenBank Accession Number: BC096716 Gene Symbol: PPP1R14D Gene ID (NCBI): 54866 RRID: AB_2878987 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NXH3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.