Iright
BRAND / VENDOR: Proteintech

Proteintech, 22090-1-AP, TXLNB Polyclonal antibody

CATALOG NUMBER: 22090-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TXLNB (22090-1-AP) by Proteintech is a Polyclonal antibody targeting TXLNB in WB, ELISA applications with reactivity to human, mouse samples 22090-1-AP targets TXLNB in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human heart tissue, mouse heart tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information TXLNB (Taxilin beta, gliding protein beta) is a protein enriched predominantly in cardiomyocytes and belongs to the centrosome articulating protein family. It is localized in the perinuclear region of the centrosome and is closely associated with the microtubule organizing center (MTOC) and the ubiquitin-proteasome system (UPS). TXLNB plays an important role in protein homeostasis in cardiomyocytes, affecting intracellular protein degradation and quality control by regulating the interactions between centrosomes and proteasomes. TXLNB was found to have a key role in cardiomyocyte hypertrophy and cardiac proteotoxicity, and its overexpression enhances proteasome activity and reduces the accumulation of ubiquitylated proteins, whereas knockdown leads to proteasome insufficiency and a decline in cardiac function with age. In addition, TXLNB may be involved in the dynamic regulation of the cytoskeleton and microtubules. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17295 Product name: Recombinant human TXLNB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 335-684 aa of BC115383 Sequence: LLNQAAEWKLQAKMLKEQETVLQAQLTLYSGRFEEFQSTLTKSNEVFATFKQEMDKTTKKMKKLEKDTATWKARFENCNKALLDMIEEKALRAKEYECFVMKIGRLENLCRALQEERNELHKKIRDAEISEKDDQSQHNSDEEPESNVSVDQEIDAEEVNSVQTAVKNLATAFMIIHHPESTPHQSKETQPEIGSSQESADAALKEPEQPPLIPSRDSESPLPPLTPQAEAEGGSDAEPPSKASNSPAGLGAETQCEGLPVGAQADQPSWKPEAEASGQAPQAPTEASLQKMEADVPAPACAAEEHVAAMVPACEPSRQPPRAAAEELPVGASAGPQPRNVADTNLEGVD Predict reactive species Full Name: taxilin beta Calculated Molecular Weight: 684 aa, 77 kDa Observed Molecular Weight: 75 kDa GenBank Accession Number: BC115383 Gene Symbol: TXLNB Gene ID (NCBI): 167838 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N3L3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924