Proteintech, 22093-1-AP, TLE1 Polyclonal antibody

Size: 20ul / 150ul The TLE1 (22093-1-AP) by Proteintech is a Polyclonal antibody targeting TLE1 in WB, ELISA applications with reactivity to human samples 22093-1-AP targets TLE1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information TLE1 (Transducin-like enhancer protein 1) is a transcriptional corepressor and binds to a number of transcription factors. It can inhibit NF-kappa-B-regulated gene expression and the transcriptional activation mediated by FOXA2, and by CTNNB1 and TCF family members in Wnt signaling. The effects of full-length TLE family members may be modulated by association with dominant-negative AES (PMID: 10660609). TLE1 is highly expressed in postnatal brain (PMID: 29758293; 27852056). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17299 Product name: Recombinant human TLE1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 281-377 aa of BC010100 Sequence: KDASSSPASTASSASSTSLKSKEMSLHEKASTPVLKSSTPTPRSDMPTPGTSATPGLRPGLGKPPAIDPLVNQAAAGLRTPLAVPGPYPAPFGMVPH Predict reactive species Full Name: transducin-like enhancer of split 1 (E(sp1) homolog, Drosophila) Calculated Molecular Weight: 770 aa, 83 kDa Observed Molecular Weight: 85-95 kDa GenBank Accession Number: BC010100 Gene Symbol: TLE1 Gene ID (NCBI): 7088 RRID: AB_3669386 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q04724 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.