Proteintech, 22097-1-AP, ISG20 Polyclonal antibody

Size: 20ul / 150ul The ISG20 (22097-1-AP) by Proteintech is a Polyclonal antibody targeting ISG20 in WB, IHC, ELISA applications with reactivity to human samples 22097-1-AP targets ISG20 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Raji cells, Daudi cells Positive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human Cited Reactivity: human, mouse, canine, monkey Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17303 Product name: Recombinant human ISG20 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-150 aa of BC007922 Sequence: MAGSREVVAMDCEMVGLGPHRESGLARCSLVNVHGAVLYDKFIRPEGEITDYRTRVSGVTPQHMVGATPFAVARLEILQLLKGKLVVGHDLKHDFQALKEDMSGYTIYDTSTDRLLWREAKLDHCRRVSLRVLSERLLHKSIQNSLLGHS Predict reactive species Full Name: interferon stimulated exonuclease gene 20kDa Calculated Molecular Weight: 181 aa, 20 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC007922 Gene Symbol: ISG20 Gene ID (NCBI): 3669 RRID: AB_2878994 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96AZ6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.