Proteintech, 22099-1-AP, Podoplanin Polyclonal antibody

Size: 20ul / 150ul The Podoplanin (22099-1-AP) by Proteintech is a Polyclonal antibody targeting Podoplanin in WB, IHC, IF-P, ELISA applications with reactivity to human samples 22099-1-AP targets Podoplanin in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human brain tissue, human placenta tissue Positive IHC detected in: human appendicitis tissue, human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human placenta tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:2000-1:8000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17307 Product name: Recombinant human PDPN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 101-238 aa of BC022812 Sequence: TGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEKDGLSTVTLVGIIVGVLLAIGFIGGIIVVVMRKMSGRYSP Predict reactive species Full Name: podoplanin Calculated Molecular Weight: 238 aa, 25 kDa Observed Molecular Weight: 43 kDa GenBank Accession Number: BC022812 Gene Symbol: Podoplanin Gene ID (NCBI): 10630 RRID: AB_2878995 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86YL7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.