Iright
BRAND / VENDOR: Proteintech

Proteintech, 22144-1-AP, LY6E Polyclonal antibody

CATALOG NUMBER: 22144-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The LY6E (22144-1-AP) by Proteintech is a Polyclonal antibody targeting LY6E in WB, ELISA applications with reactivity to human, mouse, rat samples 22144-1-AP targets LY6E in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, rat kidney tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information The predicted MW of LY6E is 13 kDa. Catalog#22144-1-AP recognises two band of 13 kDa and 18 kDa, and the additional 18 kDa band may be due to glycosylation. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17573 Product name: Recombinant human LY6E protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 21-101 aa of BC119708 Sequence: LMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFS Predict reactive species Full Name: lymphocyte antigen 6 complex, locus E Calculated Molecular Weight: 131 aa, 14 kDa Observed Molecular Weight: 12-16 kDa GenBank Accession Number: BC119708 Gene Symbol: LY6E Gene ID (NCBI): 4061 RRID: AB_2879007 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q16553 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924