Iright
BRAND / VENDOR: Proteintech

Proteintech, 22161-1-AP, ZNF154 Polyclonal antibody

CATALOG NUMBER: 22161-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ZNF154 (22161-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF154 in WB, ELISA applications with reactivity to human, monkey samples 22161-1-AP targets ZNF154 in WB, ELISA applications and shows reactivity with human, monkey samples. Tested Applications Positive WB detected in: COS-7 cells, A549 cells, HEK-293 cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Sites that display recurrent, aberrant DNA methylation in cancer represent potential biomarkers for screening and diagnostics. Previously, The hypermethylation at the ZNF154 CpG island in 15 solid epithelial tumor types from 13 different organs. The magnitude and reproducibility of the ZNF154 hypermethylation signal across five solid tumor types reinforces the potential of this site as a biomarker for circulating tumor DNA (ctDNA)(PMID: 26857064 ). The calculated molecular weight of ZNF154 is 50 kDa, but the modified ZNF154 protein is about 55-60 kDa. Specification Tested Reactivity: human, monkey Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17812 Product name: Recombinant human ZNF154 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 20-165 aa of BC152404 Sequence: AVHFSWEEWGLLDEAQRCLYRDVMLENLALLTSLDVHRQKQHLGEKHFRSNVGRALFVKTCTFHVSGEPSTCREVGKDFLAKLGFLHQQAAHTGEQSNSKSDGGAISHRGKTHYNCGEHTKAFSGKHTLVQQQRTLTTERCYICSE Predict reactive species Full Name: zinc finger protein 154 Calculated Molecular Weight: 437 aa, 50 kDa Observed Molecular Weight: 55-60 kDa GenBank Accession Number: BC152404 Gene Symbol: ZNF154 Gene ID (NCBI): 7710 RRID: AB_2879012 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13106 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924