Iright
BRAND / VENDOR: Proteintech

Proteintech, 22167-1-AP, IQGAP1 Polyclonal antibody

CATALOG NUMBER: 22167-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The IQGAP1 (22167-1-AP) by Proteintech is a Polyclonal antibody targeting IQGAP1 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse samples 22167-1-AP targets IQGAP1 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, SGC-7901 cells, HepG2 cells, NIH/3T3 cells Positive IP detected in: HeLa cells Positive IHC detected in: mouse kidney tissue, human breast cancer tissue, human colon tissue, mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells, HeLa cells, A549 cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information IQGAP1 is a member of a family of scaffolding proteins that interact with signaling and structural molecules. It localizes to sites of cell-cell contact in epithelial cells and regulates distinct cellular processes including cell adhesion, cell migration, extracellular signals through interacting with numerous protein. Multiple studies have shown that IQGAP1 is up-regulated in many human malignancies, such as lung cancer, ovarian cancer, colon cancer, breast cancer, melanoma and HCC. And IQGAP1 plays a critical role in cancer cell invasion. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17821 Product name: Recombinant human IQGAP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 478-827 aa of BC151834 Sequence: QLSSSVTGLTNIEEENCQRYLDELMKLKAQAHAENNEFITWNDIQACVDHVNLVVQEEHERILAIGLINEALDEGDAQKTLQALQIPAAKLEGVLAEVAQHYQDTLIRAKREKAQEIQDESAVLWLDEIQGGIWQSNKDTQEAQKFALGIFAINEAVESGDVGKTLSALRSPDVGLYGVIPECGETYHSDLAEAKKKKLAVGDNNSKWVKHWVKGGYYYYHNLETQEGGWDEPPNFVQNSMQLSREEIQSSISGVTAAYNREQLWLANEGLITRLQARCRGYLVRQEFRSRMNFLKKQIPAITCIQSQWRGYKQKKAYQDRLAYLRSHKDEVVKIQSLARMHQARKRYRD Predict reactive species Full Name: IQ motif containing GTPase activating protein 1 Calculated Molecular Weight: 189 kDa Observed Molecular Weight: 190-195 kDa GenBank Accession Number: BC151834 Gene Symbol: IQGAP1 Gene ID (NCBI): 8826 ENSEMBL Gene ID: ENSG00000140575 RRID: AB_10949193 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P46940 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924