Proteintech, 22170-1-AP, CPT1B-specific Polyclonal antibody

Size: 20ul / 150ul The CPT1B-specific (22170-1-AP) by Proteintech is a Polyclonal antibody targeting CPT1B-specific in WB, IHC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples 22170-1-AP targets CPT1B-specific in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse skeletal muscle tissue, mouse heart tissue, rat heart tissue, rat skeletal muscle tissue Positive IP detected in: mouse heart tissue, mouse skeletal muscle tissue Positive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse heart tissue Recommended dilution Western Blot (WB): WB : 1:20000-1:100000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information Carnitine palmitoyltransferases (CPTs) mediate the transport of long chain fatty acyl groups into the mitochondrial matrix to undergo b-oxidation. Type I CPT resides in the outer mitochondrial membrane. Mammalian tissues express three isoforms: CPT1A (liver), CPT1B (muscle and heart), and CPT1C (brain). Several isoforms of CPT1B exist due to the alternative splicing, with predicted MW of 88/84/79/66 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig, zebrafish, sheep, ewes Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17840 Product name: Recombinant human CPT1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 110-250 aa of BC131570 Sequence: FNTTRIPGKDTDVLQHLSDSRHVAVYHKGRFFKLWLYEGARLLKPQDLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAALEAIERAAFFVALDEESYSYDPEDEASLSLYGKALLHGNCYNRWF Predict reactive species Full Name: carnitine palmitoyltransferase 1B (muscle) Calculated Molecular Weight: 567 aa, 64 kDa Observed Molecular Weight: 75-85 kDa GenBank Accession Number: BC131570 Gene Symbol: CPT1B Gene ID (NCBI): 1375 RRID: AB_2713959 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92523 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.