Iright
BRAND / VENDOR: Proteintech

Proteintech, 22213-1-AP, SOSTDC1 Polyclonal antibody

CATALOG NUMBER: 22213-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SOSTDC1 (22213-1-AP) by Proteintech is a Polyclonal antibody targeting SOSTDC1 in WB, IF/ICC, ELISA applications with reactivity to human samples 22213-1-AP targets SOSTDC1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human milk Positive IF/ICC detected in: Saos-2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information SOSTDC1 (Sclerostin domain-containing protein 1), also known as Ectodin (Ectodermal BMP inhibitor), is a member of the sclerostin family. It is an N-glycosylated, secreted protein with a C-terminal cystine knot-like domain and is highly abundant in milk and kidney. This protein functions as a bone morphogenetic protein (BMP) antagonist. Specifically, it directly associates with BMPs, prohibiting them from binding their receptors, thereby regulating BMP signaling during cellular proliferation, differentiation, and programmed cell death. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17538 Product name: Recombinant human SOSTDC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 30-206 aa of BC008484 Sequence: EILYSHVVKPVPAHPSSNSTLNQARNGGRHFSNTGLDRNTRVQVGCRELRSTKYISDGQCTSISPLKELVCAGECLPLPVLPNWIGGGYGTKYWSRRSSQEWRCVNDKTRTQRIQLQCQDGSTRTYKITVVTACKCKRYTRQHNESSHNFESMSPAKPVQHHRERKRASKSSKHSMS Predict reactive species Full Name: sclerostin domain containing 1 Calculated Molecular Weight: 206 aa, 23 kDa Observed Molecular Weight: 23-26 kDa GenBank Accession Number: BC008484 Gene Symbol: SOSTDC1 Gene ID (NCBI): 25928 RRID: AB_3085688 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6X4U4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924