Proteintech, 22216-1-AP, ADAM19 Polyclonal antibody

Size: 20ul / 150ul The ADAM19 (22216-1-AP) by Proteintech is a Polyclonal antibody targeting ADAM19 in WB, ELISA applications with reactivity to human, mouse, rat samples 22216-1-AP targets ADAM19 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Meltrinβ(ADAM19) is a metalloprotease-disintegrin expressed in the peripheral nervous system and other organs during embryogenesis. Its specific patterns of expression during embryogenesis suggest that it is involved in the development of the peripheral nervous system, skeletal muscle, bone and heart tissue(PMID:12482604). It participates in the proteolytic processing of beta-type neuregulin isoforms which are involved in neurogenesis and synaptogenesis, suggesting a regulatory role in glial cell. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17544 Product name: Recombinant human ADAM19 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 291-471 aa of BC024214 Sequence: YYCCRQNNKLGQLKPSALPSKLRQQFSCPFRVSQNSGTGHANPTFKLQTPQGKRKVINTPEILRKPSQPPPRPPPDYLRGGSPPAPLPAHLSRAARNSPGPGSQIERTESSRRPPPSRPIPPAPNCIVSQDFSRPRPPQKALPANPVPGRRSLPRPGGASPLRPPGAGPQQSRPLAALAPK Predict reactive species Full Name: ADAM metallopeptidase domain 19 (meltrin beta) Calculated Molecular Weight: 955 aa, 105 kDa Observed Molecular Weight: 105 kDa GenBank Accession Number: BC024214 Gene Symbol: ADAM19 Gene ID (NCBI): 8728 RRID: AB_2879034 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H013 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.