Iright
BRAND / VENDOR: Proteintech

Proteintech, 22226-1-AP, iNOS Polyclonal antibody

CATALOG NUMBER: 22226-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The iNOS (22226-1-AP) by Proteintech is a Polyclonal antibody targeting iNOS in WB, FC (Intra), ELISA applications with reactivity to human, mouse samples 22226-1-AP targets iNOS in WB, IHC, IF, FC (Intra), CoIP, ELISA, Cell treatment applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Caco-2 cells, RAW 264.7 cells Positive FC (Intra) detected in: LPS treated RAW 264.7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information NOS2, also named as iNOS and NOS2A, produces nitric oxide (NO) which is a messenger molecule with diverse functions throughout the body. NO is a reactive free radical which acts as a biologic mediator in several processes, including neurotransmission, antimicrobial and antitumoral activities. NOS2 is a nitric oxide synthase which is expressed in liver and is inducible by a combination of lipopolysaccharide and certain cytokines. iNOS has a very short half-life due to rapid degradation by calpain. iNOS monomer is a direct substrate of calpain I and can be cleaved by calpain I at the canonical CaM-binding site(503-532aa) of iNOS, and then a ~70kD band can be detected by western (PMID:11786228). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat, chicken Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17567 Product name: Recombinant human NOS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-190 aa of BC130283 Sequence: MACPWKFLFKTKFHQYAMNGEKDINNNVEKAPCATSSPVTQDDLQYHNLSKQQNESPQPLVETGKKSPESLVKLDATPLSSPRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIMTPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQLTGDELIFAT Predict reactive species Full Name: nitric oxide synthase 2, inducible Calculated Molecular Weight: 1153 aa, 131 kDa Observed Molecular Weight: 110-130 kDa, 65-70 kDa GenBank Accession Number: BC130283 Gene Symbol: iNOS Gene ID (NCBI): 4843 RRID: AB_2879038 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P35228 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924