Product Description
Size: 20ul / 150ul
The CALCA/Calcitonin (22244-1-AP) by Proteintech is a Polyclonal antibody targeting CALCA/Calcitonin in WB, IP, ELISA applications with reactivity to human samples
22244-1-AP targets CALCA/Calcitonin in WB, IP, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: TT cells, Transfected HEK-293 cells
Positive IP detected in: TT cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Background Information
Calcitonin is a peptide hormone consisting of 32 amino acids, primarily synthesized by the parafollicular cells (C cells) of the human thyroid gland. It plays a crucial role in regulating calcium levels in the blood by decreasing them. Calcitonin opposes the actions of parathyroid hormone, which increases blood calcium levels. Calcitonin works through a G protein-coupled receptor, known as the calcitonin receptor, which predominantly transmits signals via the cAMP and PLC/IP3 pathways. Its primary physiological effects are on osteoclasts and the tubular epithelium of kidneys.
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag17737 Product name: Recombinant human CALCA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 65-141 aa of BC093753 Sequence: ELEQEQEREGSSLDSPRSKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVSMPQNAN Predict reactive species
Full Name: Calcitonin
Calculated Molecular Weight: 141 aa, 15 kDa
Observed Molecular Weight: 14 kDa, 5 kDa
GenBank Accession Number: BC093753
Gene Symbol: CALCA
Gene ID (NCBI): 796
RRID: AB_3669393
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P01258
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924