Iright
BRAND / VENDOR: Proteintech

Proteintech, 22248-1-AP, ADARB1 Polyclonal antibody

CATALOG NUMBER: 22248-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ADARB1 (22248-1-AP) by Proteintech is a Polyclonal antibody targeting ADARB1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 22248-1-AP targets ADARB1 in WB, IHC, IF, IP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, 4T1 cells, C2C12 cells, HeLa cells, NIH/3T3 cells, HepG2 cells Positive IP detected in: HeLa cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Background Information ADARB1(Double-stranded RNA-specific editase 1) is also named as ADAR2, DRADA2, RED1 and belongs to the ADAR family. It catalyses the deamination of adenosine to inosine at the GluR2 Q/R site in the pre-mRNA encoding the critical subunit of AMPA receptors. This protein has some isoforms with the molecular weight from 77 kDa to 81 kDa and 7 kDa, but it can be detected a very strong band at 50 kDa in addition to a predicted band at 75 kDa as the result of western blot, while ADARB1 has several alternative splice variants (PMID:23103828). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17743 Product name: Recombinant human ADARB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 176-392 aa of BC065545 Sequence: LFNGFETPDKAEPPFYVGSNGDDSFSSSGDLSLSASPVPASLAQPPLPALPPFPPPSGKNPVMILNELRPGLKYDFLSESGESHAKSFVMSVVVDGQFFEGSGRNKKLAKARAAQSALAAIFNLHLDQTPSRQPIPSEGLQLHLPQVLADAVSRLVLGKFGDLTDNFSSPHARRKVLAGVVMTTGTDVKDAKVISVSTGTKCINGEYMSDRGLALND Predict reactive species Full Name: adenosine deaminase, RNA-specific, B1 (RED1 homolog rat) Calculated Molecular Weight: 741 aa, 81 kDa Observed Molecular Weight: 74-86 kDa GenBank Accession Number: BC065545 Gene Symbol: ADARB1 Gene ID (NCBI): 104 RRID: AB_2879047 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P78563 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924