Iright
BRAND / VENDOR: Proteintech

Proteintech, 22321-1-AP, PBX2 Polyclonal antibody

CATALOG NUMBER: 22321-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PBX2 (22321-1-AP) by Proteintech is a Polyclonal antibody targeting PBX2 in WB, ELISA applications with reactivity to human samples 22321-1-AP targets PBX2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A2780 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17766 Product name: Recombinant human PBX2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-53 aa of BC003111 Sequence: MDERLLGPPPPGGGRGGLGLVSGEPGGPGEPPGGGDPGGGSGGVPGGRGKQDI Predict reactive species Full Name: pre-B-cell leukemia homeobox 2 Calculated Molecular Weight: 430 aa, 46 kDa Observed Molecular Weight: 50-60 kDa GenBank Accession Number: BC003111 Gene Symbol: PBX2 Gene ID (NCBI): 5089 RRID: AB_2879070 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P40425 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924