Proteintech, 22323-1-AP, PBX4 Polyclonal antibody

Size: 20ul / 150ul The PBX4 (22323-1-AP) by Proteintech is a Polyclonal antibody targeting PBX4 in WB, IP, ELISA applications with reactivity to human samples 22323-1-AP targets PBX4 in WB, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, SKOV-3 cells, A2780 cells, COLO 320 cells, Jurkat cells Positive IP detected in: A2780 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information Pre-B-cell leukemia homeobox 4 (PBX4), also named as Homeobox protein PBX4, is one of the pbx gene encode homeodomain containing transcriptional regulators that interact with other proteins to control embryogenesis and tumorigenesis. Pbx 4 expression is confined to the testis, especially to spermatocytes in the pachytene stage of the first meiotic prophase. PBX4 may form heterodimers with other homeobox genes (hoxb1b or meis3) to specify different developmental fates during vertebrate embryogenesis (PMID:10679934). The trimeric complex containing Pbx4, Meis3, and Hoxb1b was also formed. The calculated molecular weight of PBX4 is about 41 kDa, but the molecular weight of heterodimers (PBX4 and hoxb1b) is about 70 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17768 Product name: Recombinant human PBX4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 278-374 aa of BC141859 Sequence: EATIYTGKTAVDTTEVGVPGNHASCLSTPSSGSSGPFPLPSAGDAFLTLRTLASLQPPPGGGCLQSQAQGSWQGATPQPATASPAGDPGSINSSTSN Predict reactive species Full Name: pre-B-cell leukemia homeobox 4 Calculated Molecular Weight: 374 aa, 41 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC141859 Gene Symbol: PBX4 Gene ID (NCBI): 80714 RRID: AB_2879071 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q9BYU1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.