Iright
BRAND / VENDOR: Proteintech

Proteintech, 22337-1-AP, TCF4 Polyclonal antibody

CATALOG NUMBER: 22337-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TCF4 (22337-1-AP) by Proteintech is a Polyclonal antibody targeting TCF4 in WB, IHC, IF-P, IP, ELISA applications with reactivity to human, mouse samples 22337-1-AP targets TCF4 in WB, IHC, IF-P, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Caco-2 cells, K-562 cells Positive IP detected in: mouse lung tissue Positive IHC detected in: human testis tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse skeletal muscle tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information Transcription factor 4 (TCF4), also known as SEF2, ITF2, E2-2, and ME2, binds to the immunoglobulin enchancer Mu-E5/KE5-motif. Involved in the initiation of neuronal differentiation. Activates transcription by binding to the E box (5'-CANNTG-3'). Binds to the E-box present in the somatostatin receptor 2 initiator element (SSTR2-INR) to activate transcription By similarity. Human TCF4 mRNA expression is particularly high in the brain. Usage of numerous 5' exons of the human TCF4 gene potentially yields in TCF4 protein isoforms with 18 different N-termini. In addition, the diversity of isoforms is increased by alternative splicing of several internal exons. Some isoforms contain a bipartite nuclear localization signal and are exclusively nuclear, whereas distribution of other isoforms relies on heterodimerization partners. Preferentially binds to either 5'-ACANNTGT-3' or 5'-CCANNTGG-3'.TCF4 has several splicing isoforms that are expressed differentially in tissues and during cancer progression(15547706, 12796377). The scopel of molecular weight of several isoforms is about 60-90 kDa (21789225). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat, pig, drosophila Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17813 Product name: Recombinant human TCF4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 407-560 aa of BC125084 Sequence: PSTAMPGGHGDMHGIIGPSHNGAMGGLGSGYGTGLLSANRHSLMVGTHREDGVALRGSHSLLPNQVPVPQLPVQSATSPDLNPPQDPYRGMPPGLQGQSVSSGSSEIKSDDEGDENLQDTKSSEDKKLDDDKKDIKSITRSRSSNNDDEDLTPE Predict reactive species Full Name: transcription factor 4 Calculated Molecular Weight: 671 aa, 72 kDa Observed Molecular Weight: 72 kDa GenBank Accession Number: BC125084 Gene Symbol: TCF4 Gene ID (NCBI): 6925 RRID: AB_2879076 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: P15884 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924