Iright
BRAND / VENDOR: Proteintech

Proteintech, 22342-1-AP, CCL17/TARC Polyclonal antibody

CATALOG NUMBER: 22342-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CCL17/TARC (22342-1-AP) by Proteintech is a Polyclonal antibody targeting CCL17/TARC in IHC, ELISA applications with reactivity to human samples 22342-1-AP targets CCL17/TARC in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human colon tissue, human placenta tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information CCL17, also named as TARC, is a member of the CC chemokine family, and is highly expressed by thymus and other cells, including keratinocytes, endothelial cells, dendritic cells, bronchial epithelial cells and fibroblasts. CCL17 plays important roles in T cell development in thymus as well as in trafficking and activation of mature T cells. CCL17 induced chemotaxis and Ca2+ influx in the cells stably expressing CCR4, thereby demonstrating the ligand-receptor relationship between CCL17 and CCR4. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17832 Product name: Recombinant human CCL17 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 23-94 aa of BC112066 Sequence: AARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS Predict reactive species Full Name: chemokine (C-C motif) ligand 17 Calculated Molecular Weight: 94 aa, 11 kDa GenBank Accession Number: BC112066 Gene Symbol: CCL17 Gene ID (NCBI): 6361 RRID: AB_2879081 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92583 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924