Proteintech, 22355-1-AP, CXCL9/MIG Polyclonal antibody

Size: 20ul / 150ul The CXCL9/MIG (22355-1-AP) by Proteintech is a Polyclonal antibody targeting CXCL9/MIG in WB, ELISA applications with reactivity to human samples 22355-1-AP targets CXCL9/MIG in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: IFN gamma and LPS treated THP-1 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information CXCL9 is a small cytokine known as MIG. CXCL9 is a T-cell chemoattractant, which is induced by IFN-γ. It is closely related to two other CXC chemokines called CXCL10 and CXCL11, whose genes are located near the gene for CXCL9 on human chromosome 4. A high level of CXCL9 revealed in peripheral liquids, can be considered as a marker of host immune response, especially of that involving Th1 cells. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17932 Product name: Recombinant human CXCL9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 23-125 aa of BC095396 Sequence: TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT Predict reactive species Full Name: chemokine (C-X-C motif) ligand 9 Calculated Molecular Weight: 14 kDa Observed Molecular Weight: 14 kDa GenBank Accession Number: BC095396 Gene Symbol: CXCL9 Gene ID (NCBI): 4283 RRID: AB_2879086 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q07325 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.