Product Description
Size: 20ul / 150ul
The CXorf15 (22357-1-AP) by Proteintech is a Polyclonal antibody targeting CXorf15 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples
22357-1-AP targets CXorf15 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: mouse kidney tissue, HEK-293 cells, Jurkat cells, MCF-7 cells
Positive IHC detected in: mouse heart tissue, human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: HEK-293 cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200
Specification
Tested Reactivity: human, mouse
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag17936 Product name: Recombinant human CXorf15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 447-528 aa of BC101576 Sequence: ELNEKVEVLKEQVSIKAAIKAANRDLATPVMQPCTALDSHKELNTSSKRALGAHLEAEPKSQRSAVQKPPSTGSAPAIESVD Predict reactive species
Full Name: chromosome X open reading frame 15
Calculated Molecular Weight: 528 aa, 61 kDa
Observed Molecular Weight: 66 kDa
GenBank Accession Number: BC101576
Gene Symbol: CXorf15
Gene ID (NCBI): 55787
RRID: AB_2879087
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen Affinity purified
UNIPROT ID: Q9NUQ3
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924