Iright
BRAND / VENDOR: Proteintech

Proteintech, 22378-1-AP, PPARGC1B Polyclonal antibody

CATALOG NUMBER: 22378-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PPARGC1B (22378-1-AP) by Proteintech is a Polyclonal antibody targeting PPARGC1B in WB, ELISA applications with reactivity to human, rat, mouse samples 22378-1-AP targets PPARGC1B in WB, CoIP, ELISA applications and shows reactivity with human, rat, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, SH-SY5Y cells, rat liver tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: human, rat, mouse Cited Reactivity: human, mouse, pig, zebrafish, goat, fish, megalobrama amblycephala Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17566 Product name: Recombinant human PPARGC1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC132971 Sequence: MAGNDCGALLDEELSSFFLNYLADTQGGGSGEEQLYADFPELDLSQLDASDFDSATCFGELQWCPENSETEPNQYSPDDSELFQIDSENEALLAELTKTLDDIPEDDVGLAAFPALDGGDALSCTSASPAPSSAPPSPAPEKPSAPAPEVDELSLLQKLLLATSYPTSSSDTQKEGTAWRQAGLRSKSQRPCVKADSTQDKKAPMMQSQSRSCTELHKHLTSAQCCLQDRGLQPPCLQSPRLPAKEDKEPGEDCPSPQPAPASPRDSLALGRADPGAPVSQEDMQAMVQLIRYMHTYCLPQRKLPPQTPEPLPKACSNPSQQVRSRPWSRHHSKASWAEFSILRELLAQD Predict reactive species Full Name: peroxisome proliferator-activated receptor gamma, coactivator 1 beta Calculated Molecular Weight: 1023 aa, 113 kDa Observed Molecular Weight: 100-110 kDa GenBank Accession Number: BC132971 Gene Symbol: PPARGC1B Gene ID (NCBI): 133522 RRID: AB_2879093 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86YN6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924