Product Description
Size: 20ul / 150ul
The ABLIM2 (22433-1-AP) by Proteintech is a Polyclonal antibody targeting ABLIM2 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples
22433-1-AP targets ABLIM2 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: mouse brain tissue, mouse skeletal muscle tissue
Positive IP detected in: mouse brain tissue
Positive IHC detected in: mouse skeletal muscle tissue, human skeletal muscle tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC): IHC : 1:50-1:500
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag18198 Product name: Recombinant human ABLIM2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 282-389 aa of BC122567 Sequence: SIISVPASSTSGSPSRVIYAKLGGEILDYRDLAALPKSKAIYDIDRPDMISYSPYISHSAGDRQSYGEGDQDDRSYKQCRTSSPSSTGSVSLGRYTPTSRSPQHYSRP Predict reactive species
Full Name: actin binding LIM protein family, member 2
Calculated Molecular Weight: 611 aa, 68 kDa
Observed Molecular Weight: 60-70 kDa
GenBank Accession Number: BC122567
Gene Symbol: ABLIM2
Gene ID (NCBI): 84448
RRID: AB_11232422
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q6H8Q1
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924