Proteintech, 22441-1-AP, LARG Polyclonal antibody

Size: 20ul / 150ul The LARG (22441-1-AP) by Proteintech is a Polyclonal antibody targeting LARG in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 22441-1-AP targets LARG in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, HeLa cells Positive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information LARG, also known as ARHGEF12, is one of three regulator of G protein signalling (RGS) domain-containing RhoGEFs. LARG activates the ROCK pathway downstream of Gα12/13 signaling, leading to cytoskeletal reorganisation. LARG performs this activity either as a homodimer or as a heterodimer with Arhgef11. LARG has been implicated in many diseases, including cancer, heart disease, and in HIV viral replication. LARG is phosphorylated and dephosphorylated during mitosis and that Cdk1 is the mitotic kinase responsible for LARG phosphorylation. We got 220 kDa in western blotting, maybe due to its phosphorylation. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18211 Product name: Recombinant human LARG protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 214-563 aa of BC063117 Sequence: QRLLKEIQEAKKHIPQLQEQLSKATGSAQDGAVVTPSRPLGDTLTVSEAETDPGDVLGRTDCSSGDASRPSSDNADSPKSGPKERIYLEENPEKSETIQDTDTQSLVGSPSTRIAPHIIGAEDDDFGTEHEQINGQCSCFQSIELLKSRPAHLAVFLHHVVSQFDPATLLCYLYSDLYKHTNSKETRRIFLEFHQFFLDRSAHLKVSVPDEMSADLEKRRPELIPEDLHRHYIQTMQERVHPEVQRHLEDFRQKRSMGLTLAESELTKLDAERDKDRLTLEKERTCAEQIVAKIEEVLMTAQAVEEDKSSTMQYVILMYMKHLGVKVKEPRNLEHKRGRIGFLPKIKQSM Predict reactive species Full Name: Rho guanine nucleotide exchange factor (GEF) 12 Calculated Molecular Weight: 1544 aa, 173 kDa Observed Molecular Weight: 220 kDa GenBank Accession Number: BC063117 Gene Symbol: LARG Gene ID (NCBI): 23365 RRID: AB_2879107 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NZN5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.