Iright
BRAND / VENDOR: Proteintech

Proteintech, 22474-1-AP, FOXA2 Polyclonal antibody

CATALOG NUMBER: 22474-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FOXA2 (22474-1-AP) by Proteintech is a Polyclonal antibody targeting FOXA2 in WB, IHC, IF-P, IP, ELISA applications with reactivity to human samples 22474-1-AP targets FOXA2 in WB, IHC, IF-P, IP, CoIP, chIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HT-29 cells, HepG2 cells, A549 cells, MDA-MB-231 cells Positive IP detected in: HepG2 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: rat stomach tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:2000-1:8000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information FOXA2 also named as HNF 3 beta or TCF3B is a 457 amino acid protein, which contains one fork-head DNA-binding domains. FOXA2 can Shuttle between the nucleus and cytoplasm in a CRM1-dependent manner. Phosphorylation on FOXA2 Thr-156 abolishes binding to target promoters and subsequent transcription activation upon INS stimulation. FOXA2 as a transcription factor involves in embryonic development, establishment of tissue-specific gene expression and regulation of gene expression in differentiated tissues. The molecular weight of FOXA2 is 48kDa, but the phosphorylated FOXA2 may be a 55-65kDa protein. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18221 Product name: Recombinant human FOXA2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-160 aa of BC011780 Sequence: MLGAVKMEGHEPSDWSSYYAEPEGYSSVSNMNAGLGMNGMNTYMSMSAAAMGSGSGNMSAGSMNMSSYVGAGMSPSLAGMSPGAGAMAGMGGSAGAAGVAGMGPHLSPSLSPLGGQAAGAMGGLAPYANMNSMSPMYGQAGLSRARDPKTYRRSYTHAKP Predict reactive species Full Name: forkhead box A2 Calculated Molecular Weight: 457 aa, 48 kDa Observed Molecular Weight: 55-65 kDa GenBank Accession Number: BC011780 Gene Symbol: FOXA2 Gene ID (NCBI): 3170 RRID: AB_2879110 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y261 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924